DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and GSTF2

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_192161.1 Gene:GSTF2 / 827931 AraportID:AT4G02520 Length:212 Species:Arabidopsis thaliana


Alignment Length:183 Identity:38/183 - (20%)
Similarity:72/183 - (39%) Gaps:23/183 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYG-------KDDA 65
            |:|....:....||.....|:..||...:|...|....::|||||..|:..:|.       :.|:
plant    27 LDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLQTDS 91

  Fly    66 LYPKDIQKQAVINQRLYFDMALMYPTLANYYYK-------AFTTGQFGSEEDYKKVQETFDFLNT 123
               |:|.:.|::...:..:.....|..:...::       ..||.:....|:..|:.:..|....
plant    92 ---KNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEA 153

  Fly   124 FLEGQDYVAGDQYTVADIAILANVSNFDVVGFDISKY----PNVARWYDHVKK 172
            .|:...|:||:.:|:.|:..:..:..  ::|....|.    |.|..|...:.|
plant   154 RLKEFKYLAGETFTLTDLHHIPAIQY--LLGTPTKKLFTERPRVNEWVAEITK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 15/49 (31%)
GstA 6..173 CDD:223698 38/183 (21%)
GST_C_Delta_Epsilon 72..188 CDD:198287 19/112 (17%)
GSTF2NP_192161.1 GST_N_Phi 4..78 CDD:239351 15/50 (30%)
GST_C_Phi 96..211 CDD:198296 19/111 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.