DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and ATGSTF13

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_191835.1 Gene:ATGSTF13 / 825451 AraportID:AT3G62760 Length:219 Species:Arabidopsis thaliana


Alignment Length:197 Identity:48/197 - (24%)
Similarity:87/197 - (44%) Gaps:41/197 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKD---DALYPKD 70
            ||....:|........|.|:.:||...:|.|.|:..|::|||||..|:.||: :|   |....:|
plant    27 EFELVPVNLFACHHKLPSFLSMNPFGKVPALQDDDLTLFESRAITAYIAEKH-RDKGTDLTRHED 90

  Fly    71 IQKQAVINQRLYFDMALMY--PTLANYYYKAFTTGQFGSEEDYKKVQETFDFLNTFLEGQD---- 129
            .::.|::  :|:.::...:  |.::...::.......|...:...|:|..:.|...|:..:    
plant    91 PKEAAIV--KLWSEVEAHHFNPAISAVIHQLIVVPLQGESPNAAIVEENLENLGKILDVYEERLG 153

  Fly   130 ---YVAGDQYTVADI-----------AILANVSNFDVVGFDISKYPNVARWYDHV------KKIT 174
               |:|||.||:||:           .|.|.:         |:..|||..|::.:      .|::
plant   154 KTKYLAGDTYTLADLHHVPYTYYFMKTIHAGL---------INDRPNVKAWWEDLCSRPAFLKVS 209

  Fly   175 PG 176
            ||
plant   210 PG 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 17/48 (35%)
GstA 6..173 CDD:223698 45/192 (23%)
GST_C_Delta_Epsilon 72..188 CDD:198287 26/131 (20%)
ATGSTF13NP_191835.1 PLN02395 1..209 CDD:166036 46/193 (24%)
GST_N_Phi 2..77 CDD:239351 17/49 (35%)
GST_C_Phi 92..208 CDD:198296 23/126 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.