DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and GSTF11

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_186969.1 Gene:GSTF11 / 821227 AraportID:AT3G03190 Length:214 Species:Arabidopsis thaliana


Alignment Length:190 Identity:47/190 - (24%)
Similarity:84/190 - (44%) Gaps:26/190 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKY---GKDDALYPK 69
            :||....::..|.||..|..:...|...:|.:.|....::|||||..|...||   |.|  |..|
plant    26 IEFEVIHVDLDKLEQKKPQHLLRQPFGQVPAIEDGYLKLFESRAIARYYATKYADQGTD--LLGK 88

  Fly    70 DIQKQAVINQRL-----YFDMALMYPTLANYYYKAFTTGQFGSEEDYKKVQE-------TFDFLN 122
            .::.:|:::|.:     || .|:..|.:.|..:|.    :.|...|...|:|       ..|...
plant    89 TLEGRAIVDQWVEVENNYF-YAVALPLVMNVVFKP----KSGKPCDVALVEELKVKFDKVLDVYE 148

  Fly   123 TFLEGQDYVAGDQYTVADIAILAN---VSNFDVVGFDISKYPNVARWYDHVKKITPGWEE 179
            ..|....|:.||::|:||::.:..   :.|...:...::...|:.||::.: ...|.|::
plant   149 NRLATNRYLGGDEFTLADLSHMPGMRYIMNETSLSGLVTSRENLNRWWNEI-SARPAWKK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 15/49 (31%)
GstA 6..173 CDD:223698 45/182 (25%)
GST_C_Delta_Epsilon 72..188 CDD:198287 26/123 (21%)
GSTF11NP_186969.1 PLN02473 1..214 CDD:166114 47/190 (25%)
GST_N_Phi 2..77 CDD:239351 15/50 (30%)
GST_C_Phi 91..209 CDD:198296 26/123 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.