DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and GSTF10

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_180644.1 Gene:GSTF10 / 817637 AraportID:AT2G30870 Length:215 Species:Arabidopsis thaliana


Alignment Length:188 Identity:56/188 - (29%)
Similarity:89/188 - (47%) Gaps:20/188 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKY---GKDDALYP 68
            |:.|....::.:||||..|:::.|.|...||.|||..:.|:|||||:.|:.|||   |.|  |..
plant    24 GVSFETVNVDLMKGEQRQPEYLAIQPFGKIPVLVDGDYKIFESRAIMRYIAEKYRSQGPD--LLG 86

  Fly    69 KDIQKQAVINQRLYFDMALMYPTL----ANYYY---KAFTTGQFGSEEDYKKVQETFDFLNTFLE 126
            |.|:::..:.|.|..:....:|.|    .|..:   ..|...:...:|..:|:.|..|.....|.
plant    87 KTIEERGQVEQWLDVEATSYHPPLLALTLNIVFAPLMGFPADEKVIKESEEKLAEVLDVYEAQLS 151

  Fly   127 GQDYVAGDQYTVADIAILANVSNFDVVG-----FDISKYPNVARWYDHVKKITPGWEE 179
            ..:|:|||..::||:|.|.....  :||     ..|....:|:.|:|.:.. ...|:|
plant   152 KNEYLAGDFVSLADLAHLPFTEY--LVGPIGKAHLIKDRKHVSAWWDKISS-RAAWKE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 21/50 (42%)
GstA 6..173 CDD:223698 54/180 (30%)
GST_C_Delta_Epsilon 72..188 CDD:198287 27/120 (23%)
GSTF10NP_180644.1 PLN02395 1..215 CDD:166036 56/188 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.