DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and GSTZ1

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_973400.1 Gene:GSTZ1 / 814770 AraportID:AT2G02390 Length:228 Species:Arabidopsis thaliana


Alignment Length:215 Identity:58/215 - (26%)
Similarity:97/215 - (45%) Gaps:51/215 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GLEFNKKIINTLKGEQMN-------PDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDD 64
            ||::....:|.|||:|.:       .||.||||..::|.|||....|.:|.||::||.||| .:.
plant    31 GLDYEYIPVNLLKGDQFDSVYRFDLQDFKKINPMGTVPALVDGDVVINDSFAIIMYLDEKY-PEP 94

  Fly    65 ALYPKDIQKQAVINQRLYFDMALMYP--TLANYYYKAFTTGQFGSEEDYKKVQETFDFLN----- 122
            .|.|:|:.|:||..|.:...::.:.|  .||...|          .|:...|:|...::|     
plant    95 PLLPRDLHKRAVNYQAMSIVLSGIQPHQNLAVIRY----------IEEKINVEEKTAWVNNAITK 149

  Fly   123 --TFLE------GQDYVAGDQYTVADI----AILANVSNFDVVGFDISKYPNVARWYDHVKKITP 175
              |.||      ...:..||:..:||:    .|...::.|.:   ::..||.:|:.|:...:: |
plant   150 GFTALEKLLVNCAGKHATGDEIYLADLFLAPQIHGAINRFQI---NMEPYPTLAKCYESYNEL-P 210

  Fly   176 GWEENWAGALDVKKRIEEKQ 195
            .::          ..:.|||
plant   211 AFQ----------NALPEKQ 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 23/57 (40%)
GstA 6..173 CDD:223698 54/191 (28%)
GST_C_Delta_Epsilon 72..188 CDD:198287 26/134 (19%)
GSTZ1NP_973400.1 GST_N_Zeta 9..88 CDD:239340 22/56 (39%)
maiA 10..224 CDD:273527 58/215 (27%)
GST_C_Zeta 101..220 CDD:198300 27/142 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1283865at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.