DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and GDAP1L1

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001243666.1 Gene:GDAP1L1 / 78997 HGNCID:4213 Length:386 Species:Homo sapiens


Alignment Length:185 Identity:35/185 - (18%)
Similarity:67/185 - (36%) Gaps:62/185 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVGKALGLEFNKKIINTLKGEQMNPDFIKIN----PQHSIPTLVDNGFTIWESRAILVYLVEKYG 61
            |:.|....|..:.:.|.      ..|.:|::    ||.|.|.|.       :.:.::..::|   
Human   191 MIPKYATAEIRRHLANA------TTDLMKLDHEEEPQLSEPYLS-------KQKKLMAKILE--- 239

  Fly    62 KDDALYPKDIQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQFGSEEDYKKVQETFDFLNTFLE 126
            .||..|.|.|..:.                       |....|..:|.:.:|::.         |
Human   240 HDDVSYLKKILGEL-----------------------AMVLDQIEAELEKRKLEN---------E 272

  Fly   127 GQD---YVAGDQYTVADIAILANVSNFDVVGFDISKY------PNVARWYDHVKK 172
            ||.   ::.|..:|:||:.:.|.:.....:|.. .||      ||:..:::.|::
Human   273 GQKCELWLCGCAFTLADVLLGATLHRLKFLGLS-KKYWEDGSRPNLQSFFERVQR 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 11/60 (18%)
GstA 6..173 CDD:223698 33/180 (18%)
GST_C_Delta_Epsilon 72..188 CDD:198287 18/110 (16%)
GDAP1L1NP_001243666.1 GstA 47..333 CDD:223698 35/185 (19%)
GST_N_GDAP1 47..119 CDD:239350
GST_C_GDAP1L1 220..330 CDD:198335 29/150 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154480
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1283865at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.