DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and gdap1l1

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001072239.1 Gene:gdap1l1 / 779687 XenbaseID:XB-GENE-950543 Length:364 Species:Xenopus tropicalis


Alignment Length:237 Identity:46/237 - (19%)
Similarity:83/237 - (35%) Gaps:98/237 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EQMNPDFIKINPQHSIPTL----------------VDNGF-------------TIWESRAILVY- 55
            |...|.|:::|....:|.:                ::|.|             ||:.|| :|.| 
 Frog    81 EHKEPWFMRLNLGEEVPVVIHGDNIISDYNQIIDYIENNFVGELIPKLIPETETIFHSR-VLQYR 144

  Fly    56 -LVEKYGKD--------------DALYPKDIQKQAVINQRL-----------YFDMALMYPTLA- 93
             :::|...|              |::.||  ...|.|.:.|           :.:..||.|.|: 
 Frog   145 EILDKLPMDAYTHGCILHPELTTDSMIPK--YATAEIRRHLANASTELTKLDHEEPQLMEPYLSK 207

  Fly    94 --------------NYYYK-----AFTTGQFGSEEDYKKVQETFDFLNTFLEGQD---YVAGDQY 136
                          ||..|     :....|..:|.:.:|::         .|||.   ::.|..:
 Frog   208 QKKLMAKILEHDNVNYLTKILIQLSMVLDQIEAELEKRKLE---------YEGQKCELWLCGHIF 263

  Fly   137 TVADIAILANVSNFDVVGFDISKY------PNVARWYDHVKK 172
            |:||:.:.|.:.....:|.. .||      ||:..::|.::|
 Frog   264 TLADVLLGATLHRLKFLGLS-KKYWEDGSRPNLQLFFDRIQK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 13/67 (19%)
GstA 6..173 CDD:223698 46/237 (19%)
GST_C_Delta_Epsilon 72..188 CDD:198287 28/141 (20%)
gdap1l1NP_001072239.1 Thioredoxin_like 45..117 CDD:381987 5/35 (14%)
GST_C_family 198..308 CDD:383119 25/117 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1283865at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.