DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and Clic3

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_030107910.1 Gene:Clic3 / 69454 MGIID:1916704 Length:268 Species:Mus musculus


Alignment Length:178 Identity:34/178 - (19%)
Similarity:66/178 - (37%) Gaps:58/178 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPKDI 71
            |:.|....::|.:...:..||.   |...:|.|:.:|....::..|..:|.|..|..|       
Mouse    68 GVPFTLTTVDTRRALDVLKDFA---PGSQLPILLYDGDVKTDTLQIEEFLEETLGPPD------- 122

  Fly    72 QKQAVINQRLYFDMALMYPTLANYYYKAFTTG-----QFGS-------EED---YKKVQETFDFL 121
                             :|:||..|.::.|.|     :|.:       .:|   |:::......|
Mouse   123 -----------------FPSLAPRYRESNTAGNDIFHKFSAFIKNPVPTQDNALYQQLLRALTRL 170

  Fly   122 NTFLEG----------------QDYVAGDQYTVADIAILANVSNFDVV 153
            :::|..                :.::.|||:|:||.::|..:...|.|
Mouse   171 DSYLRAPLDHELAQEPHLRESHRRFLDGDQFTLADCSLLPKLHIVDTV 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 11/50 (22%)
GstA 6..173 CDD:223698 34/178 (19%)
GST_C_Delta_Epsilon 72..188 CDD:198287 20/113 (18%)
Clic3XP_030107910.1 O-ClC 43..261 CDD:129941 34/178 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844724
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.