DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and GstD10

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster


Alignment Length:190 Identity:120/190 - (63%)
Similarity:149/190 - (78%) Gaps:1/190 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVGKALGLEFNKK-IINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDD 64
            |..||||:||:|| ||||...||..|:::||||||:||||.|:||.:||||||:|||||||||||
  Fly    17 MTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESRAIMVYLVEKYGKDD 81

  Fly    65 ALYPKDIQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQFGSEEDYKKVQETFDFLNTFLEGQD 129
            .|:|||:||||:|||||||||..:|.:.:.|||......:..:||:|||::..|:|||||||||.
  Fly    82 KLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKPANEENYKKIEVAFEFLNTFLEGQT 146

  Fly   130 YVAGDQYTVADIAILANVSNFDVVGFDISKYPNVARWYDHVKKITPGWEENWAGALDVKK 189
            |.||..|::||||.||.||.|||.|||..:|.||||||::.||:||||||||||..:.:|
  Fly   147 YSAGGDYSLADIAFLATVSTFDVAGFDFKRYANVARWYENAKKLTPGWEENWAGCQEFRK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 38/57 (67%)
GstA 6..173 CDD:223698 105/167 (63%)
GST_C_Delta_Epsilon 72..188 CDD:198287 69/115 (60%)
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 38/57 (67%)
PLN02473 3..196 CDD:166114 113/178 (63%)
GST_C_Delta_Epsilon 89..205 CDD:198287 69/115 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468466
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113221at6960
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.