DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and eef1e1

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001373479.1 Gene:eef1e1 / 565440 ZFINID:ZDB-GENE-030131-4949 Length:173 Species:Danio rerio


Alignment Length:160 Identity:43/160 - (26%)
Similarity:76/160 - (47%) Gaps:25/160 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IPTLV-DNGFTIWESRAILVYLVEKYGKDDALYPKDIQKQAVINQRLYFDMALMYPTLANYYYKA 99
            :|.|. :||..:.....|..:|| |..|...|...|.:::||:.|.|...:.    .|.|.    
Zfish    29 VPVLQNNNGPALTGLVTIACHLV-KEAKRPELLGDDAEQRAVVQQWLEHRIT----KLDNC---- 84

  Fly   100 FTTGQFGSEEDYKKVQETFDFLNTFLEGQDYVAGDQYTVADIAILANVSNFDVVGFDISK---YP 161
                   |:|:.|.:.:.   ||.:||.:.|:||:.:|:|||.:...:.:. :|...|.:   |.
Zfish    85 -------SKEEVKVILKD---LNRYLEDKVYLAGNVFTLADILMYYGIHHI-IVELAIQEKECYL 138

  Fly   162 NVARWYDHVKKITPGWEENWAGALDVKKRI 191
            ||:||:||::.. ||...:....:.::.|:
Zfish   139 NVSRWFDHIQHY-PGIRHHLPPVVVLRNRV 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 6/22 (27%)
GstA 6..173 CDD:223698 40/140 (29%)
GST_C_Delta_Epsilon 72..188 CDD:198287 31/118 (26%)
eef1e1NP_001373479.1 GST_C_AIMP3 64..161 CDD:198338 31/116 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.