DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and gstr

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001038525.1 Gene:gstr / 564619 ZFINID:ZDB-GENE-090507-1 Length:226 Species:Danio rerio


Alignment Length:185 Identity:40/185 - (21%)
Similarity:78/185 - (42%) Gaps:15/185 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKY-GKDDALYPKDIQK 73
            :..|:::..|.|..:|:...:||:..:||.......:.||.|..:||...: .:...|.|.:..:
Zfish    31 YKHKLLSFDKKEHQSPEVKALNPRAQLPTFKHGEIVVNESFAACLYLESVFKSQGTRLIPDNPAE 95

  Fly    74 QAVINQRLYFDMAL---MYPTLANYYYKAFTTG---QFGSEEDYKKVQETFDFLNTFLEGQ---D 129
            .|::.||::....|   ||...  :|......|   :...:.:.:|:.|.......:||..   .
Zfish    96 MALVYQRMFETENLQQKMYEVA--FYDWLVPEGERLESALKRNKEKLIEELKLWEGYLEKMGKGS 158

  Fly   130 YVAGDQYTVADIAILANVSNFDVVGFDISKYPNVARWYDHVK---KITPGWEENW 181
            |:||..:::||:.....::.|..:.....:.|.:..:|:.||   .|...|...|
Zfish   159 YLAGKNFSMADVVCFPVIAYFPRLQCPKERCPRLMEYYEMVKDRPSIKASWPPEW 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 13/47 (28%)
GstA 6..173 CDD:223698 37/175 (21%)
GST_C_Delta_Epsilon 72..188 CDD:198287 25/122 (20%)
gstrNP_001038525.1 GstA 5..207 CDD:223698 38/177 (21%)
GST_N_family 5..78 CDD:238319 12/46 (26%)
GST_C_family 99..199 CDD:198286 19/101 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589681
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518126at33208
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.