DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and gstt1a

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001314691.1 Gene:gstt1a / 563972 ZFINID:ZDB-GENE-031001-13 Length:242 Species:Danio rerio


Alignment Length:179 Identity:47/179 - (26%)
Similarity:86/179 - (48%) Gaps:18/179 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPKDIQ 72
            :.|..|.::...|||...:|.|::....:|.|.|..|.:.||.|||:||..|:...|..||.|:|
Zfish    26 IPFEYKAVDLSAGEQYGDEFGKVSIIRKVPALKDGDFLLTESIAILLYLAGKHSTPDHWYPADLQ 90

  Fly    73 KQAVINQRLYFDMALMYPTLAN-----YYYKAFTTGQFGSEEDYKKVQETFDFLN--------TF 124
            |:|.:::.|    :..:..:.:     :::|.......|:....:|:....:.||        .|
Zfish    91 KRAQVDEFL----SWQHTNIRSHGSKVFWFKGVLPAVTGAPVPKEKMDSALEDLNMSLKIFEDKF 151

  Fly   125 LEGQDYVAGDQYTVADIAILANVSNFDVVGFDISK-YPNVARWYDHVKK 172
            |:.:.::.||:.::|||..:..:......|.|:.: .|.::.|.|.|||
Zfish   152 LQSRPFIIGDKISLADIVAIVEMMQPVATGVDVFEGRPALSAWRDRVKK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 18/49 (37%)
GstA 6..173 CDD:223698 47/179 (26%)
GST_C_Delta_Epsilon 72..188 CDD:198287 24/115 (21%)
gstt1aNP_001314691.1 GstA 3..199 CDD:223698 44/176 (25%)
GST_N_Theta 3..78 CDD:239348 18/51 (35%)
GST_C_Theta 91..217 CDD:198292 23/114 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518126at33208
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.