DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and gdap1l1

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_687373.1 Gene:gdap1l1 / 562163 ZFINID:ZDB-GENE-080812-2 Length:367 Species:Danio rerio


Alignment Length:248 Identity:42/248 - (16%)
Similarity:81/248 - (32%) Gaps:92/248 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYL--------------- 56
            ||...::.::....||..|.|:::|....:|..:.....:.:...|:.|:               
Zfish    70 GLLCEERDVSLPLTEQKEPWFMRLNLGEEVPVFIHGDTIVSDYNQIIDYIETNFVGDTVAQLIPD 134

  Fly    57 --------VEKYGK---------------------DDALYPK--------------------DIQ 72
                    |::|.:                     .|::.||                    |.:
Zfish   135 EGTPMYARVQQYRELLDGLPMDAYTHGCILHPELTTDSMIPKYATAEIRRHLANAASELMKLDHE 199

  Fly    73 KQAVINQRLYFDMALMYPTL----ANYYYK-----AFTTGQFGSEEDYKKVQETFDFLNTFLEGQ 128
            :..:....|.....||...|    .||..|     |....|..:|.:.:|::         .:||
Zfish   200 EPQLTEPYLSKQKKLMAKILDHDNVNYLKKILGELAMVLDQVEAELEKRKLE---------YQGQ 255

  Fly   129 D---YVAGDQYTVADIAILANVSNFDVVGFDISKY------PNVARWYDHVKK 172
            .   ::.|..:|:|||.:.|.:.....:|.. .||      ||:..:::.|:|
Zfish   256 KCELWLCGPTFTLADICLGATLHRLKFLGLS-RKYWEDGSRPNLQSFFERVQK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 10/73 (14%)
GstA 6..173 CDD:223698 42/248 (17%)
GST_C_Delta_Epsilon 72..188 CDD:198287 26/119 (22%)
gdap1l1XP_687373.1 GstA 48..314 CDD:223698 42/248 (17%)
Thioredoxin_like 48..120 CDD:294274 10/49 (20%)
GST_C_GDAP1L1 201..311 CDD:198335 26/117 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589631
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1283865at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.