Sequence 1: | NP_788656.1 | Gene: | GstD3 / 48336 | FlyBaseID: | FBgn0010039 | Length: | 199 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018511.1 | Gene: | gdap1 / 553702 | ZFINID: | ZDB-GENE-050522-424 | Length: | 362 | Species: | Danio rerio |
Alignment Length: | 237 | Identity: | 43/237 - (18%) |
---|---|---|---|
Similarity: | 85/237 - (35%) | Gaps: | 73/237 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 GLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDA--LYPK 69
Fly 70 D-------IQKQAVINQRLYFDM----ALMYPTL-ANYYYKAFTT----GQFG-SEEDYKKV--- 114
Fly 115 ----------------QETFD-----FLNTFL-----------------------EG--QDYVAG 133
Fly 134 DQYTVADIAILANVSNFDVVGFDISKYPNVAR-----WYDHV 170 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD3 | NP_788656.1 | GST_N_Delta_Epsilon | <1..58 | CDD:239343 | 14/50 (28%) |
GstA | 6..173 | CDD:223698 | 43/237 (18%) | ||
GST_C_Delta_Epsilon | 72..188 | CDD:198287 | 27/163 (17%) | ||
gdap1 | NP_001018511.1 | GstA | 40..307 | CDD:223698 | 43/237 (18%) |
GST_N_GDAP1 | 40..112 | CDD:239350 | 13/49 (27%) | ||
GST_C_family | 193..304 | CDD:295467 | 16/106 (15%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589671 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |