DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and gdap1

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001018511.1 Gene:gdap1 / 553702 ZFINID:ZDB-GENE-050522-424 Length:362 Species:Danio rerio


Alignment Length:237 Identity:43/237 - (18%)
Similarity:85/237 - (35%) Gaps:73/237 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDA--LYPK 69
            ||:.....::....|...|.|:::||...:|.||.:...|.:...|:.||.:.:..:..  |.|:
Zfish    62 GLQCEDYDVSLPLSEHNEPWFMRLNPTGEVPVLVHDNHVICDPTQIMDYLEQNFCDEQTPKLIPE 126

  Fly    70 D-------IQKQAVINQRLYFDM----ALMYPTL-ANYYYKAFTT----GQFG-SEEDYKKV--- 114
            :       :|....:...|..|.    .:::|.: .:.:..|:.|    .|.| :|.:.||:   
Zfish   127 EGSTYYHRVQHYRELLDSLQMDAYTHGCILHPEITVDSHIPAYATTHIRTQIGNTESELKKLAVE 191

  Fly   115 ----------------QETFD-----FLNTFL-----------------------EG--QDYVAG 133
                            .:.||     :|...|                       ||  |.::.|
Zfish   192 NPDLKDAYIAKQRRLKSKLFDHDNMKYLKKLLDELENVLDQVETELQRRSEETPEEGSQQAWLCG 256

  Fly   134 DQYTVADIAILANVSNFDVVGFDISKYPNVAR-----WYDHV 170
            |.:::||:::...:.....:|.....:.|..|     :|:.|
Zfish   257 DFFSIADVSLAVTLHRLKFLGLSRRYWGNGMRVNLETYYERV 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 14/50 (28%)
GstA 6..173 CDD:223698 43/237 (18%)
GST_C_Delta_Epsilon 72..188 CDD:198287 27/163 (17%)
gdap1NP_001018511.1 GstA 40..307 CDD:223698 43/237 (18%)
GST_N_GDAP1 40..112 CDD:239350 13/49 (27%)
GST_C_family 193..304 CDD:295467 16/106 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589671
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.