DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and Gstt3

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_038954940.1 Gene:Gstt3 / 499422 RGDID:1562732 Length:298 Species:Rattus norvegicus


Alignment Length:190 Identity:47/190 - (24%)
Similarity:79/190 - (41%) Gaps:34/190 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYP 68
            |..|:.|..:.|..|||:.....|.::||...:|.|.|..|.:.||.|||:||..||...|..||
  Rat    79 KKNGIPFQLRTIELLKGQHYTDAFAQVNPLRKVPALKDGDFVLAESVAILLYLSRKYKAPDHWYP 143

  Fly    69 KDIQKQAVINQRLYFD-------------MALMYPTLANYYYKAFTTGQFGSEEDYKKVQETFDF 120
            :|:|.:|.:::.|.:.             ..:|:|..            .|.....:::..|...
  Rat   144 QDLQTRARVDEYLAWQHTALRSCCSRAMWQKMMFPVF------------LGQPVPPERLASTLAE 196

  Fly   121 L--------NTFLEGQDYVAGDQYTVADIAILANVSNFDVVGFDI-SKYPNVARWYDHVK 171
            |        :.||:.:.::.|...:|||:..:..:.:....|..| ...|.:|.|...|:
  Rat   197 LDGCLQMLEDKFLQNKAFLTGPHISVADLVAITELMHPVSAGCKIFESRPKLAAWRQRVE 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 21/53 (40%)
GstA 6..173 CDD:223698 46/188 (24%)
GST_C_Delta_Epsilon 72..188 CDD:198287 20/122 (16%)
Gstt3XP_038954940.1 GST_N_Theta 60..135 CDD:239348 21/55 (38%)
GST_C_Theta 149..273 CDD:198292 19/120 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348120
Domainoid 1 1.000 62 1.000 Domainoid score I10049
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518126at33208
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.650

Return to query results.
Submit another query.