DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and gstt1-like.2

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_031748213.1 Gene:gstt1-like.2 / 496693 XenbaseID:XB-GENE-980731 Length:245 Species:Xenopus tropicalis


Alignment Length:174 Identity:49/174 - (28%)
Similarity:86/174 - (49%) Gaps:11/174 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KALGLEFNKKIINTLK-GEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALY 67
            ||..:.||...:..|| ||.:..:|.|::..|.:|.|.|..||:.||.|:|:||..||...:..|
 Frog    25 KANRIPFNYCKLQLLKAGEHLTQEFGKVSVLHKVPALKDGNFTMAESTAMLLYLARKYKTPNHWY 89

  Fly    68 PKDIQKQAVINQRLYFDMALMYPTLANYYY-KAFTTGQFGSEEDYKKVQETF-DFLNT------- 123
            |.|:||:|.:::.|.:......|..:..:: |..:....|.|...:|:.... :|:.|       
 Frog    90 PSDLQKRARVDEYLAWQHTNTRPHGSKVFWTKCVSPTILGKEVPSEKMNAVMAEFVTTMNNFEEK 154

  Fly   124 FLEGQDYVAGDQYTVADIAILANVSNFDVVGFDI-SKYPNVARW 166
            ||..:.::|||:.:|||:..:..:......|.:: .:.|.:..|
 Frog   155 FLGNKPFIAGDEISVADLVAIVEIMQVIASGVNVFEERPKLGSW 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 22/54 (41%)
GstA 6..173 CDD:223698 47/172 (27%)
GST_C_Delta_Epsilon 72..188 CDD:198287 22/105 (21%)
gstt1-like.2XP_031748213.1 GST_N_Theta 6..82 CDD:239348 22/56 (39%)
GST_C_Theta 95..221 CDD:198292 21/104 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518126at33208
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.