DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and clic5a

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001007386.1 Gene:clic5a / 492513 ZFINID:ZDB-GENE-041114-84 Length:246 Species:Danio rerio


Alignment Length:179 Identity:40/179 - (22%)
Similarity:60/179 - (33%) Gaps:43/179 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPKDI 71
            |:.||   :.|:..::...|...:.|....|.|..||....:...|..:|.|......  |||..
Zfish    42 GVVFN---VTTVDLKRKPADLHNLAPGTPPPFLTFNGEVRTDVNKIEEFLEEMLAPPK--YPKLA 101

  Fly    72 QKQAVINQRLYFDMALMYPTLANYYYKAFTT--------GQFGSEEDYKKVQETFD-FLNTFL-- 125
            .|....|            |..|..:..|:.        .....|:...||.:..| |||:.|  
Zfish   102 AKNKESN------------TAGNDIFAKFSAYIKNTKPEANASLEKGLLKVLKKLDSFLNSPLPD 154

  Fly   126 ------------EGQDYVAGDQYTVADIAILANVSNFDVVGFDISKYPN 162
                        ..:.|:.|::.|:||..:|..:....||.   .||.|
Zfish   155 EIDAESTGEEKSSNRKYLDGNELTLADCNLLPKLHVVKVVS---KKYRN 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 12/50 (24%)
GstA 6..173 CDD:223698 40/179 (22%)
GST_C_Delta_Epsilon 72..188 CDD:198287 24/114 (21%)
clic5aNP_001007386.1 GST_N_CLIC 8..97 CDD:239359 13/59 (22%)
O-ClC 10..244 CDD:129941 40/179 (22%)
GST_C_CLIC5 104..244 CDD:198330 23/112 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589660
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.