DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and GstD4

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster


Alignment Length:199 Identity:129/199 - (64%)
Similarity:157/199 - (78%) Gaps:0/199 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVGKALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDA 65
            ||.||||||.|||.:...:||.:.|:|:|:||||:|||||||||.|||||||.|||||||||||:
  Fly    17 MVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAIAVYLVEKYGKDDS 81

  Fly    66 LYPKDIQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQFGSEEDYKKVQETFDFLNTFLEGQDY 130
            |:|.|.||:|:|||||||||..::.:...|||....|||.|:.|:||||:..|:||:.|||||||
  Fly    82 LFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGNAENYKKVEAAFEFLDIFLEGQDY 146

  Fly   131 VAGDQYTVADIAILANVSNFDVVGFDISKYPNVARWYDHVKKITPGWEENWAGALDVKKRIEEKQ 195
            |||.|.||||||||::||.|:||.|||||||||||||.:.|||||||:|||.|.|.:|...|.::
  Fly   147 VAGSQLTVADIAILSSVSTFEVVEFDISKYPNVARWYANAKKITPGWDENWKGLLQMKTMYEAQK 211

  Fly   196 NAAK 199
            .:.|
  Fly   212 ASLK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 39/56 (70%)
GstA 6..173 CDD:223698 111/166 (67%)
GST_C_Delta_Epsilon 72..188 CDD:198287 76/115 (66%)
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 113/166 (68%)
GST_N_Delta_Epsilon 1..74 CDD:239343 39/56 (70%)
GST_C_Delta_Epsilon 88..204 CDD:198287 76/115 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468485
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113221at6960
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.