DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and gstt1

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001006811.1 Gene:gstt1 / 448525 XenbaseID:XB-GENE-998695 Length:242 Species:Xenopus tropicalis


Alignment Length:203 Identity:58/203 - (28%)
Similarity:91/203 - (44%) Gaps:14/203 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYP 68
            ||..:.||...:...|||.:..::.|:|....:|.|.|..|.:.||.|:|:|:..|:...|..||
 Frog    23 KANNIPFNNHQVRLFKGEHLTEEYGKVNVLRKVPALKDCDFFMAESTAMLLYMARKFKTADHWYP 87

  Fly    69 KDIQKQAVINQRLYFDMALMYPTLAN-YYYKAFTTGQFGSEEDYKKVQETFDFLNT--------F 124
            .||||.|.:::.|.:......|..:. ::.|..|....|.|...:||.......||        |
 Frog    88 SDIQKCAKVDEYLAWQHTNTRPNGSKVFWVKCLTPLILGQEAPAEKVDAVVAEFNTTMNNFEEKF 152

  Fly   125 LEGQDYVAGDQYTVADIAILANVSNFDVVGFDI-SKYPNVARWYDHVKKITPGWE---ENWAGAL 185
            |..:.::|||:.:|||:..:..:......|.:: ...|.:|.|...|.:.. |.|   |...|.|
 Frog   153 LGNKLFIAGDEISVADLVAIVEIMQVVAGGINVFDDRPKLAAWKKRVVEAL-GEELFLEAHEGIL 216

  Fly   186 DVKKRIEE 193
            :.||...|
 Frog   217 NAKKMASE 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 18/53 (34%)
GstA 6..173 CDD:223698 48/176 (27%)
GST_C_Delta_Epsilon 72..188 CDD:198287 31/128 (24%)
gstt1NP_001006811.1 GST_N_Theta 4..79 CDD:239348 18/55 (33%)
GST_C_Theta 92..217 CDD:198292 29/125 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518126at33208
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.