DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and clic2

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001002561.2 Gene:clic2 / 436834 ZFINID:ZDB-GENE-040718-299 Length:239 Species:Danio rerio


Alignment Length:199 Identity:39/199 - (19%)
Similarity:73/199 - (36%) Gaps:63/199 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GLEFNKKIINTLKGEQMNPDFIK-INPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPKD 70
            |::|....::..|    .||.:| :.|..:.|.|:.|| |:               |.|.:..::
Zfish    43 GVKFTVTTVDMRK----KPDELKDLAPGTNPPFLLYNG-TL---------------KTDFIKIEE 87

  Fly    71 IQKQAVINQRLYFDMALMYPTLANYYYKAFTTG-----------------QFGSEEDYKKVQETF 118
            ..:..:...|        ||.|:..|.::|..|                 .|..:...::.:...
Zfish    88 FLETTLAPPR--------YPHLSPRYKESFDVGADIFAKFSAFIKNSPNNAFHEKALLREFKRLD 144

  Fly   119 DFLNTFLEGQ----------DYVAGDQYTVADIAILANVSNFDVVGFDISKYPNVARWYDHVKKI 173
            |:|||.|:.:          .::.|::.|:||..:|..:   .|:.....||.|    :|...:.
Zfish   145 DYLNTPLQDELDQNISVSKRKFLDGNRLTLADCNLLPKL---HVIKVAARKYCN----FDIPTQF 202

  Fly   174 TPGW 177
            |..|
Zfish   203 TGVW 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 12/51 (24%)
GstA 6..173 CDD:223698 37/193 (19%)
GST_C_Delta_Epsilon 72..188 CDD:198287 25/133 (19%)
clic2NP_001002561.2 O-ClC 11..238 CDD:129941 39/199 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589562
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.