Sequence 1: | NP_788656.1 | Gene: | GstD3 / 48336 | FlyBaseID: | FBgn0010039 | Length: | 199 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002561.2 | Gene: | clic2 / 436834 | ZFINID: | ZDB-GENE-040718-299 | Length: | 239 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 39/199 - (19%) |
---|---|---|---|
Similarity: | 73/199 - (36%) | Gaps: | 63/199 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 GLEFNKKIINTLKGEQMNPDFIK-INPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPKD 70
Fly 71 IQKQAVINQRLYFDMALMYPTLANYYYKAFTTG-----------------QFGSEEDYKKVQETF 118
Fly 119 DFLNTFLEGQ----------DYVAGDQYTVADIAILANVSNFDVVGFDISKYPNVARWYDHVKKI 173
Fly 174 TPGW 177 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD3 | NP_788656.1 | GST_N_Delta_Epsilon | <1..58 | CDD:239343 | 12/51 (24%) |
GstA | 6..173 | CDD:223698 | 37/193 (19%) | ||
GST_C_Delta_Epsilon | 72..188 | CDD:198287 | 25/133 (19%) | ||
clic2 | NP_001002561.2 | O-ClC | 11..238 | CDD:129941 | 39/199 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589562 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |