DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and GstD9

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster


Alignment Length:191 Identity:103/191 - (53%)
Similarity:136/191 - (71%) Gaps:2/191 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVGKALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDA 65
            |..:|||||.|||.::...||.:.|:|:||||||:||||||:||.||||||||:||.|||.||.:
  Fly    18 MTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAILIYLAEKYDKDGS 82

  Fly    66 LYPKDIQKQAVINQRLYFDMALMYPTLANYYY-KAFTTGQFGSEED-YKKVQETFDFLNTFLEGQ 128
            |||||.|::|||||||:||::.:|.:...||| :.|...:..::.| .||:.:.|...||.|:||
  Fly    83 LYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLKKIDDAFAMFNTLLKGQ 147

  Fly   129 DYVAGDQYTVADIAILANVSNFDVVGFDISKYPNVARWYDHVKKITPGWEENWAGALDVKK 189
            .|.|.::.|:||.|:||.||.|::..:|..|||.|.||||:.||:.|||||||.|....||
  Fly   148 QYAALNKLTLADFALLATVSTFEISEYDFGKYPEVVRWYDNAKKVIPGWEENWEGCEYYKK 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 37/56 (66%)
GstA 6..173 CDD:223698 90/168 (54%)
GST_C_Delta_Epsilon 72..188 CDD:198287 54/117 (46%)
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 37/56 (66%)
GstA 4..187 CDD:223698 89/168 (53%)
GST_C_Delta_Epsilon 89..207 CDD:198287 54/117 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468467
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113221at6960
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.