DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and MARS1

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_004981.2 Gene:MARS1 / 4141 HGNCID:6898 Length:900 Species:Homo sapiens


Alignment Length:146 Identity:34/146 - (23%)
Similarity:67/146 - (45%) Gaps:22/146 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GKALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTL-VDNGFTIWESRAILVY--LVEKYGKDD 64
            |:|.|..  :.:|:|:..|.....|:   .:..:|.| :|:|..::.:.||..|  |:..:.:||
Human    20 GRARGRA--EVLISTVGPEDCVVPFL---TRPKVPVLQLDSGNYLFSTSAICRYFFLLSGWEQDD 79

  Fly    65 ALYPKDIQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQFGSEEDYKKVQETFDFLNTFLEGQD 129
                       :.||.|.::...:.|.|:...|.....|:.| |:....|:.....::..|..|:
Human    80 -----------LTNQWLEWEATELQPALSAALYYLVVQGKKG-EDVLGSVRRALTHIDHSLSRQN 132

  Fly   130 --YVAGDQYTVADIAI 143
              ::||:..::|||.:
Human   133 CPFLAGETESLADIVL 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 15/57 (26%)
GstA 6..173 CDD:223698 32/143 (22%)
GST_C_Delta_Epsilon 72..188 CDD:198287 17/74 (23%)
MARS1NP_004981.2 Thioredoxin_like <27..68 CDD:294274 10/43 (23%)
GstA <47..189 CDD:223698 27/114 (24%)
GST_C_MetRS_N 77..179 CDD:198340 19/84 (23%)
PRK12268 264..819 CDD:237029
MetRS_core 265..633 CDD:173907
'HIGH' region 273..283
'KMSKS' region 593..597
Anticodon_Ia_Met 642..771 CDD:153411
MetRS_RNA 845..889 CDD:238475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.