DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and GstZ1

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster


Alignment Length:169 Identity:38/169 - (22%)
Similarity:79/169 - (46%) Gaps:18/169 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPKDIQKQAVIN 78
            ::.|:.|.....::.::||...:|:|..:|.|:.:|.||:.|| |:.....||.|:|..|:|.|.
  Fly    66 LLKTVSGHAYTDEYREVNPMQKVPSLKIDGHTLCDSVAIIHYL-EETRPQPALLPQDPVKRAKIR 129

  Fly    79 QRLYFDMALMYPTLANYYYKAFTTGQFGSEEDYKKVQETFDFLNTFLEGQD---------YVAGD 134
            :.:....:.:.| |.|    .......|.::..:..|.   :::...:|.:         :..||
  Fly   130 EIVELICSGIQP-LQN----VSVLDHIGKDQSLQWAQH---WISRGFQGLEKVLSHSAGKFCVGD 186

  Fly   135 QYTVADIAILANVSNFDVVGFDISKYPNVARWYDHVKKI 173
            :.::|||.::..|.|......|::.||.:.|....::::
  Fly   187 ELSMADICLVPQVRNARRYKADLTPYPTIVRLNQELQEL 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 13/43 (30%)
GstA 6..173 CDD:223698 38/167 (23%)
GST_C_Delta_Epsilon 72..188 CDD:198287 20/111 (18%)
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 13/43 (30%)
maiA 35..240 CDD:273527 38/169 (22%)
GST_C_Zeta 122..236 CDD:198300 20/112 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460381
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1283865at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.