DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and gstt1b

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_956878.1 Gene:gstt1b / 393556 ZFINID:ZDB-GENE-040426-1491 Length:242 Species:Danio rerio


Alignment Length:178 Identity:49/178 - (27%)
Similarity:88/178 - (49%) Gaps:10/178 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYP 68
            |...::|:.|.|:..:|.|...:|.||||....||:.|..|.:.||.||::||.:|:...|..:|
Zfish    22 KKNNIQFDYKKISLFEGYQYGEEFGKINPLRKFPTIKDGDFCLAESVAIMIYLADKFHTPDHWFP 86

  Fly    69 KDIQKQAVINQRLYFD-MALMYPTLANYYYKAFTTGQFGSEEDYKKVQETFDFLNT--------F 124
            .|:||:|.:|:.|.:. .::........::|.......|:|...:|::...:.||.        |
Zfish    87 ADLQKRARVNEYLSWQHTSIRMHGAKIIWFKILIPEVLGAEVPKEKMENAEENLNVALQLFQDKF 151

  Fly   125 LEGQDYVAGDQYTVADIAILANVSNFDVVGFDI-SKYPNVARWYDHVK 171
            |:.:.::.|||.::||:..:..:......|.|: ...|.:..|.|.|:
Zfish   152 LQDKPFIVGDQISLADLVAIVEIMQPFAAGMDVFENRPKLKAWKDRVR 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 21/53 (40%)
GstA 6..173 CDD:223698 48/176 (27%)
GST_C_Delta_Epsilon 72..188 CDD:198287 24/110 (22%)
gstt1bNP_956878.1 GstA 1..199 CDD:223698 48/176 (27%)
GST_N_Theta 3..78 CDD:239348 21/55 (38%)
GST_C_Theta 91..217 CDD:198292 23/109 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518126at33208
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.