DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and gstt2

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_956815.2 Gene:gstt2 / 393493 ZFINID:ZDB-GENE-040426-1617 Length:228 Species:Danio rerio


Alignment Length:213 Identity:63/213 - (29%)
Similarity:98/213 - (46%) Gaps:39/213 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NKKIINTL------KGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPK 69
            :.||.:|:      ||||..|:|.|:||...:|.|.||||.:.||.|||.||...|...|..|||
Zfish    27 HNKIPHTVEQIAIRKGEQKTPEFTKLNPMQKVPVLEDNGFVLTESDAILKYLATTYKVPDHWYPK 91

  Fly    70 DIQKQAVI---------NQRLY----FDMALMYPTLANYYYKAFTTGQFGS----EEDYKKVQET 117
            ..:|:|.:         |.|::    |...::.|.:         |||..:    |:....:..|
Zfish    92 LPEKRARVDEYTAWHHMNTRMHAATVFWQEVLLPLM---------TGQPANTAKLEKALSDLSGT 147

  Fly   118 FDFL-NTFLEGQDYVAGDQYTVADIAILANVSNFDVVGFDISK-YPNVARWYDHVKK-ITPGWEE 179
            .|.| |.||:.|.::.||..::||:..:..:......|.||.| .|.:..|...|:. ::..::|
Zfish   148 LDKLENMFLKRQAFLCGDDISLADLLAICELMQPMSSGRDILKDRPKLLSWRSRVQSALSDSFDE 212

  Fly   180 NWAGALDVKKRIEEKQNA 197
                |..:..|:.:|..|
Zfish   213 ----AHTIVYRLRDKFTA 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 25/52 (48%)
GstA 6..173 CDD:223698 58/187 (31%)
GST_C_Delta_Epsilon 72..188 CDD:198287 30/135 (22%)
gstt2NP_956815.2 GST_N_Theta 7..82 CDD:239348 25/54 (46%)
GST_C_Theta 95..220 CDD:198292 30/137 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589535
Domainoid 1 1.000 50 1.000 Domainoid score I11638
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518126at33208
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.