DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and GstE12

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster


Alignment Length:204 Identity:72/204 - (35%)
Similarity:113/204 - (55%) Gaps:5/204 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVGKALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYG-KDD 64
            :..||:||:...:.||.||||.:.|:|:|:||||:||||:|...||.:|.||..||||||| |:.
  Fly    20 LTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHAICAYLVEKYGQKEQ 84

  Fly    65 ALYPKDIQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQFG-SEEDYKKVQETFDFLNTFLEGQ 128
            .||||::.::|.::.||:.|...::..|...|......|... |.:....:|:.::.|..||:.|
  Fly    85 QLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTDCSIDKIAYIQKCWEILEGFLKDQ 149

  Fly   129 DYVAGDQYTVADIAILANVSNF-DVVGFDISKYPNVARWYDHVKKITPGWEENWAGALDVKKRIE 192
            .|:.|...|:||...:|.|::. |....|..|:|.:..|...:.::....|.|..||.::|...:
  Fly   150 PYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFPKMHAWLKRLAELPYYQEVNGDGADELKSIFK 214

  Fly   193 EK--QNAAK 199
            .|  :|..|
  Fly   215 AKLAENRGK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 29/56 (52%)
GstA 6..173 CDD:223698 62/169 (37%)
GST_C_Delta_Epsilon 72..188 CDD:198287 29/117 (25%)
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 29/56 (52%)
GstA 6..201 CDD:223698 64/180 (36%)
GST_C_Delta_Epsilon 92..210 CDD:198287 29/117 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460351
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518126at33208
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.