DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and GstE11

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster


Alignment Length:205 Identity:65/205 - (31%)
Similarity:114/205 - (55%) Gaps:12/205 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVGKALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGK--D 63
            :...|||||.:.:::|...||..:.:|:|:|.||:||.|.|||..:.:|..|..||.:||..  |
  Fly    21 LTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHIICSYLADKYAPEGD 85

  Fly    64 DALYPKDIQKQAVINQRLYFDMALMYPTLANYYYKA--FTTGQFGSEEDYKKVQETFDFLNTFLE 126
            |:|||||.:|:.:::.|||:|...::|.:.......  |..|:..|:. ...:|:.:|.|...|.
  Fly    86 DSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGAGEVPSDR-VAYLQKAYDGLEHCLA 149

  Fly   127 GQDYVAGDQYTVADIAILANVSNFDVVG-FDISKYPNVARWYDHVKKITPGWEENWAGALD---- 186
            ..||:.||:.|:||::.:|:||..:... .:..::|.:.:|...::.: |.:::|....||    
  Fly   150 EGDYLVGDKLTIADLSCIASVSTAEAFAPIEPDQFPRLVQWVKRIQAL-PYYQKNNQEGLDMLVG 213

  Fly   187 -VKKRIEEKQ 195
             ||..:.|:|
  Fly   214 LVKGLLAERQ 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 23/56 (41%)
GstA 6..173 CDD:223698 56/171 (33%)
GST_C_Delta_Epsilon 72..188 CDD:198287 29/123 (24%)
GstE11NP_001286575.1 GstA 5..198 CDD:223698 57/178 (32%)
GST_N_Delta_Epsilon 5..78 CDD:239343 23/56 (41%)
GST_C_Delta_Epsilon 94..211 CDD:198287 29/118 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460352
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518126at33208
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.