DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and GstE5

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster


Alignment Length:194 Identity:75/194 - (38%)
Similarity:123/194 - (63%) Gaps:17/194 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPK 69
            ||.|.:....:|....||::.:::|.||:|::|||.|:|..||:|.||:.|||.||...|||||:
  Fly    24 ALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWDSHAIIAYLVSKYADSDALYPR 88

  Fly    70 DIQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQFGS------EEDYKKVQETFDFLNTFLEGQ 128
            |:.::||::|||:|:..:::   || ..||.|...|.:      :|.|..:.|.:||:.|||.|.
  Fly    89 DLLQRAVVDQRLHFETGVVF---AN-GIKAITKPLFFNGLNRIPKERYDAIVEIYDFVETFLAGH 149

  Fly   129 DYVAGDQYTVADIAILANVSNFDVVGF---DISKYPNVARWYDHVKKITPGWEE-NWAGALDVK 188
            ||:||||.|:||.::::::::  :|.|   |..|||.:..|...::|: |.:|| |..||.:::
  Fly   150 DYIAGDQLTIADFSLISSITS--LVAFVEIDRLKYPRIIEWVRRLEKL-PYYEEANAKGARELE 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 22/52 (42%)
GstA 6..173 CDD:223698 67/175 (38%)
GST_C_Delta_Epsilon 72..188 CDD:198287 44/125 (35%)
GstE5NP_611327.1 GstA 4..196 CDD:223698 69/178 (39%)
Thioredoxin_like 4..77 CDD:294274 22/52 (42%)
GST_C_Delta_Epsilon 91..209 CDD:198287 44/124 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460348
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518126at33208
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.