DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and GstE3

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster


Alignment Length:200 Identity:75/200 - (37%)
Similarity:126/200 - (63%) Gaps:14/200 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYP 68
            :||.|:|:.||:|.::.|.:.|:|:||||.|::|.|.||||.:.:|.||..|||.|||::|:|||
  Fly    23 RALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADSHAINSYLVSKYGRNDSLYP 87

  Fly    69 KDIQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQFGSEED------YKKVQETFDFLNTFLEG 127
            ||::|:|:::|||::|.:::..|     .:|.|...|...:.      ...::..:..||.|||.
  Fly    88 KDLKKRAIVDQRLHYDSSVVTST-----GRAITFPLFWENKTEIPQARIDALEGVYKSLNLFLEN 147

  Fly   128 QDYVAGDQYTVADIAILANVSNFDV-VGFDISKYPNVARWYDHVKKITPGWEE-NWAGALDVKKR 190
            .:|:|||..|:||..::|.::.|.| :..|.:|||.:|.|...:|:: |.:|| |.:.|..:.:.
  Fly   148 GNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKYPELAAWIKRIKEL-PYYEEANGSRAAQIIEF 211

  Fly   191 IEEKQ 195
            |:.|:
  Fly   212 IKSKK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 26/53 (49%)
GstA 6..173 CDD:223698 67/173 (39%)
GST_C_Delta_Epsilon 72..188 CDD:198287 37/123 (30%)
GstE3NP_611325.2 GstA 4..195 CDD:223698 68/177 (38%)
GST_N_Delta_Epsilon 4..77 CDD:239343 26/53 (49%)
GST_C_Delta_Epsilon 91..208 CDD:198287 37/122 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460343
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518126at33208
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.