DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and GstE2

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster


Alignment Length:193 Identity:68/193 - (35%)
Similarity:110/193 - (56%) Gaps:11/193 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYP 68
            :||.|::..|.::.|.|:.....|:|.||||::|.|.|||..||:|.||:.|||:||...|.|||
  Fly    24 RALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWDSHAIVCYLVDKYANSDELYP 88

  Fly    69 KDIQKQAVINQRLYFDMALMYPTLAN----YYYKAFTTGQFGSEEDYKKVQETFDFLNTFLEGQD 129
            :|:..:|.::|||:||.::::.:|.|    |:.:..:   ...:|....:::.:..|..||....
  Fly    89 RDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVS---LVPKEKVDNIKDAYGHLENFLGDNP 150

  Fly   130 YVAGDQYTVADIAILANVSNF-DVVGFDISKYPNVARWYDHVKKITPGWEENWAGALDVKKRI 191
            |:.|.|.|:||:...|..|:. .|:..|..|||.||.|::.:.|:....|:|..|   :||.|
  Fly   151 YLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAAWFERLSKLPHYEEDNLRG---LKKYI 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 24/53 (45%)
GstA 6..173 CDD:223698 60/171 (35%)
GST_C_Delta_Epsilon 72..188 CDD:198287 33/120 (28%)
GstE2NP_611324.1 GstA 5..196 CDD:223698 62/174 (36%)
GST_N_Delta_Epsilon 5..78 CDD:239343 24/53 (45%)
GST_C_Delta_Epsilon 94..209 CDD:198287 34/120 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460345
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518126at33208
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.