DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and GstE10

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster


Alignment Length:199 Identity:64/199 - (32%)
Similarity:106/199 - (53%) Gaps:12/199 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYP 68
            :||.|:.....::...|:.:.||.::.||||::|.|.|....||:|.||:.|||.||.:.|.|||
  Fly    23 RALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCIWDSHAIIGYLVNKYAQSDELYP 87

  Fly    69 KDIQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQFGS------EEDYKKVQETFDFLNTFLEG 127
            ||..|:||::|||:|:..:::..:    :|......|..      ::...::::.:..|..||..
  Fly    88 KDPLKRAVVDQRLHFETGVLFHGI----FKQLQRALFKENATEVPKDRLAELKDAYALLEQFLAE 148

  Fly   128 QDYVAGDQYTVADIAILANVS--NFDVVGFDISKYPNVARWYDHVKKITPGWEENWAGALDVKKR 190
            ..||||.|.|:||.:|:|.||  :......|.:|||.::.|...:..:....|:|..||..:..:
  Fly   149 NPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLSAWLARISALPFYEEDNLRGARLLADK 213

  Fly   191 IEEK 194
            |..|
  Fly   214 IRSK 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 20/53 (38%)
GstA 6..173 CDD:223698 57/174 (33%)
GST_C_Delta_Epsilon 72..188 CDD:198287 33/123 (27%)
GstE10NP_001286570.1 GstA 4..197 CDD:223698 58/177 (33%)
GST_N_Delta_Epsilon 4..77 CDD:239343 20/53 (38%)
GST_C_Delta_Epsilon 91..211 CDD:198287 33/123 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460340
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.790

Return to query results.
Submit another query.