DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and GstE14

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster


Alignment Length:195 Identity:54/195 - (27%)
Similarity:114/195 - (58%) Gaps:6/195 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVGKALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDA 65
            |:.|.|.::...:.:|..||||...||:.:|||||:||||.....:.:|.|||::|.||:.:..:
  Fly    22 MLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTDSHAILIHLAEKFDEGGS 86

  Fly    66 LYPKDIQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQFGSEE---DYKKVQETFDFLNTFLEG 127
            |:|::..::..:...|.|:.:.::...:::.......| |.:.:   ..:|:.|.:..:..:||.
  Fly    87 LWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQG-FANVDVAHHERKLTEAYIIMERYLEN 150

  Fly   128 QDYVAGDQYTVADIAILANVSNFDVVGFDISKYPNVARWYDHVKKITPGWEENWAGALDVKKRIE 192
            .|::||.|.|:||::|:..:|..::: |.:|::|.:.||:..:::: ..:|.|.:|...:::.:|
  Fly   151 SDFMAGPQLTLADLSIVTTLSTVNLM-FPLSQFPRLRRWFTAMQQL-DAYEANCSGLEKLRQTME 213

  Fly   193  192
              Fly   214  213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 24/56 (43%)
GstA 6..173 CDD:223698 48/169 (28%)
GST_C_Delta_Epsilon 72..188 CDD:198287 25/118 (21%)
GstE14NP_610855.1 GstA 6..200 CDD:223698 50/180 (28%)
GST_N_Delta_Epsilon 6..79 CDD:239343 24/56 (43%)
GST_C_Delta_Epsilon 94..209 CDD:198287 25/117 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518126at33208
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.