DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and GstE13

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster


Alignment Length:209 Identity:61/209 - (29%)
Similarity:115/209 - (55%) Gaps:14/209 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVGKALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIW-ESRAILVYLVEKYGKDD 64
            :|.|.:||:...|.::..|.|.::.:|:|:||||.||..||:...:: :|.||:.:||.||..:|
  Fly    20 LVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSHAIVCFLVAKYAGND 84

  Fly    65 ALYPKDIQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQFGSEEDYKK-----VQETFDFLNTF 124
            .|||:|::::|.|:.|::::..:::..:.:...:..    :|.|.:|..     ....:..|..|
  Fly    85 QLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNI----YGGEGEYNPRSLTLCHNAYSDLEHF 145

  Fly   125 LEGQDYVAGDQYTVADIAILANVSNFD-VVGFDISKYPNVARWYDHVKKITPGWEE-NWAGALDV 187
            |:...:|.|::.:|||::|...:...| ::..:..|||...:|.:.:.|:.|..|| |..||..:
  Fly   146 LQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKYPQTKQWMERMDKLLPDNEEINLKGARAL 210

  Fly   188 KKRIEE--KQNAAK 199
            :.||..  .:|.||
  Fly   211 QTRILSCMAENKAK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 21/57 (37%)
GstA 6..173 CDD:223698 47/173 (27%)
GST_C_Delta_Epsilon 72..188 CDD:198287 27/122 (22%)
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 21/57 (37%)
GST_C_Delta_Epsilon 92..211 CDD:198287 27/122 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460346
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.890

Return to query results.
Submit another query.