DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and mars1

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_956370.1 Gene:mars1 / 338183 ZFINID:ZDB-GENE-030219-83 Length:922 Species:Danio rerio


Alignment Length:115 Identity:28/115 - (24%)
Similarity:43/115 - (37%) Gaps:32/115 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LGLEFNKKIINTL-KGEQMNPDFIKINPQHSIPTL----VDNGF--TIWESRAILVYLVEKYGKD 63
            ||.:.|..::|.| ..|.:|.:..|.:....:...    .|.|.  .:|  |..|:|| ...|:|
Zfish   567 LGAQDNYTLVNNLIATEYLNYEDTKFSKSRGVGVFGDMAKDTGIPSDVW--RFYLLYL-RPEGQD 628

  Fly    64 DALYPKDIQKQAVINQRLYFDMAL-----MYPTLANYYYKAFTTGQFGSE 108
            .|.              .:.||||     :...|.|:..:|   |.|.|:
Zfish   629 SAF--------------SWTDMALKNNSELLNNLGNFINRA---GMFVSK 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 15/58 (26%)
GstA 6..173 CDD:223698 28/115 (24%)
GST_C_Delta_Epsilon 72..188 CDD:198287 10/42 (24%)
mars1NP_956370.1 GstA 1..173 CDD:223698
GST_N_family 1..67 CDD:238319
GST_C_MetRS_N 75..176 CDD:198340
PRK12268 261..820 CDD:237029 28/115 (24%)
MetRS_core 263..631 CDD:173907 17/66 (26%)
Anticodon_Ia_Met 640..769 CDD:153411 6/25 (24%)
MetRS_RNA 866..910 CDD:238475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.