DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and Clic

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster


Alignment Length:147 Identity:31/147 - (21%)
Similarity:58/147 - (39%) Gaps:19/147 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 INTLKGEQMNPDF-IKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPKDIQKQAVIN 78
            :.|:..::..||| ......|. |.|:|||..|.|:..|..::::.......|:.:| ::.|.:.
  Fly    63 VTTVDMQKPPPDFRTNFEATHP-PILIDNGLAILENEKIERHIMKNIPGGYNLFVQD-KEVATLI 125

  Fly    79 QRLYFDMALMYPTLANYYYKAFTTGQFGSEEDYKKVQETFDFLNTFLEGQDYVAGDQYTVADIAI 143
            :.||..:.||..........|..:       ..:|:.:.....||     .::.||.....|..:
  Fly   126 ENLYVKLKLMLVKKDEAKNNALLS-------HLRKINDHLSARNT-----RFLTGDTMCCFDCEL 178

  Fly   144 LANVSNFDVVGFDISKY 160
            :..:.:..|.|    ||
  Fly   179 MPRLQHIRVAG----KY 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 13/43 (30%)
GstA 6..173 CDD:223698 31/147 (21%)
GST_C_Delta_Epsilon 72..188 CDD:198287 16/89 (18%)
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 13/49 (27%)
O-ClC 21..231 CDD:129941 31/147 (21%)
GST_C_CLIC 118..232 CDD:198307 17/91 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460362
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.