DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and Gdap1

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001101367.1 Gene:Gdap1 / 312890 RGDID:1309005 Length:358 Species:Rattus norvegicus


Alignment Length:225 Identity:43/225 - (19%)
Similarity:79/225 - (35%) Gaps:74/225 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKY----------GKDDALYPKDIQKQA 75
            |...|.|:::|....:|.|:.....|.|:..|:.||.:.:          .:....||: :|...
  Rat    62 EHNEPWFMRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDEGSMYYPR-VQHYR 125

  Fly    76 VINQRLYFDM----ALMYPTL-ANYYYKAFTT----GQFG-SEEDYKKVQE-------------- 116
            .:...|..|.    .:::|.| .:....|:.|    ||.| :|.:.||:.|              
  Rat   126 ELLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRGQIGNTESELKKLAEENPDLQEAYIAKQK 190

  Fly   117 ------------------------TFDFLNTFLE----------GQDYVAGDQYTVADIAILANV 147
                                    ..|.:.|.|:          .|.::.|:.:|:||:::...:
  Rat   191 RLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPDEGNQPWLCGESFTLADVSLAVTL 255

  Fly   148 SNFDVVGF-----DISKYPNVARWYDHVKK 172
            .....:||     ...|.||:..:|:.|.|
  Rat   256 HRLKFLGFARRNWGHGKRPNLESYYERVLK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 11/36 (31%)
GstA 6..173 CDD:223698 43/225 (19%)
GST_C_Delta_Epsilon 72..188 CDD:198287 30/164 (18%)
Gdap1NP_001101367.1 GstA 26..292 CDD:223698 43/225 (19%)
GST_N_GDAP1 26..98 CDD:239350 10/35 (29%)
GST_C_GDAP1 179..289 CDD:198336 16/107 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348240
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.