DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and Gdap1l1

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_038961050.1 Gene:Gdap1l1 / 311616 RGDID:1304960 Length:369 Species:Rattus norvegicus


Alignment Length:248 Identity:43/248 - (17%)
Similarity:80/248 - (32%) Gaps:92/248 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDD--ALYPK 69
            ||...::.::..:.|...|.|:::|....:|.::.....|.:...|:.|:...:..:.  ||.|:
  Rat    72 GLSCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFTGEHVVALMPE 136

  Fly    70 --DIQKQAVINQRLYFD---------------------MALMYPT------LAN----------- 94
              ..|...|:..|...|                     |...|.|      |||           
  Rat   137 AGSPQHARVLQYRELLDALPMDAYTHGCILHPELTTDSMIPKYATAEIRRHLANATTDLMKLDHE 201

  Fly    95 --------------------------YYYK-----AFTTGQFGSEEDYKKVQETFDFLNTFLEGQ 128
                                      |..|     |....|..:|.:.:|::.         |||
  Rat   202 EPQLSEPYLSKQKKLMAKILEHDDVGYLKKILGELAMVLDQIEAELEKRKLEN---------EGQ 257

  Fly   129 D---YVAGDQYTVADIAILANVSNFDVVGFDISKY------PNVARWYDHVKK 172
            .   ::.|..:|:||:.:.|.:.....:|.. .||      ||:..:::.|::
  Rat   258 TCELWLCGCAFTLADVLLGATLHRLKFLGLS-KKYWEDGSRPNLQSFFERVQR 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 10/50 (20%)
GstA 6..173 CDD:223698 43/248 (17%)
GST_C_Delta_Epsilon 72..188 CDD:198287 30/179 (17%)
Gdap1l1XP_038961050.1 Thioredoxin_like 47..122 CDD:412351 10/49 (20%)
GST_C_family 203..313 CDD:413470 20/117 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348210
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1283865at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.