Sequence 1: | NP_788656.1 | Gene: | GstD3 / 48336 | FlyBaseID: | FBgn0010039 | Length: | 199 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038961050.1 | Gene: | Gdap1l1 / 311616 | RGDID: | 1304960 | Length: | 369 | Species: | Rattus norvegicus |
Alignment Length: | 248 | Identity: | 43/248 - (17%) |
---|---|---|---|
Similarity: | 80/248 - (32%) | Gaps: | 92/248 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 GLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDD--ALYPK 69
Fly 70 --DIQKQAVINQRLYFD---------------------MALMYPT------LAN----------- 94
Fly 95 --------------------------YYYK-----AFTTGQFGSEEDYKKVQETFDFLNTFLEGQ 128
Fly 129 D---YVAGDQYTVADIAILANVSNFDVVGFDISKY------PNVARWYDHVKK 172 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD3 | NP_788656.1 | GST_N_Delta_Epsilon | <1..58 | CDD:239343 | 10/50 (20%) |
GstA | 6..173 | CDD:223698 | 43/248 (17%) | ||
GST_C_Delta_Epsilon | 72..188 | CDD:198287 | 30/179 (17%) | ||
Gdap1l1 | XP_038961050.1 | Thioredoxin_like | 47..122 | CDD:412351 | 10/49 (20%) |
GST_C_family | 203..313 | CDD:413470 | 20/117 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166348210 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1283865at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.850 |