DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and Clic3

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001013098.2 Gene:Clic3 / 296566 RGDID:1307249 Length:237 Species:Rattus norvegicus


Alignment Length:178 Identity:33/178 - (18%)
Similarity:61/178 - (34%) Gaps:58/178 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPKDI 71
            |:.|....::|.:...:..||.   |...:|.|:.:|....::..|..:|.|..|..|       
  Rat    37 GVPFTLTTVDTRRALDVLKDFA---PGSQLPILLYDGDVKTDTLQIEEFLEETLGPPD------- 91

  Fly    72 QKQAVINQRLYFDMALMYPTLANYY-------------YKAFTTGQFGSEED--YKKVQETFDFL 121
                             :|.||..|             :.||......:::|  |:::......|
  Rat    92 -----------------FPGLAPRYRESNTAGNDIFHKFSAFIKNPVPTQDDALYQQLLRALTRL 139

  Fly   122 NTFL----------------EGQDYVAGDQYTVADIAILANVSNFDVV 153
            :.:|                ..:.::.|||.|:||.::|..:...|.|
  Rat   140 DRYLGTPLDHELAQEPHLSESRRRFLDGDQLTLADCSLLPKLHIVDTV 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 11/50 (22%)
GstA 6..173 CDD:223698 33/178 (19%)
GST_C_Delta_Epsilon 72..188 CDD:198287 19/113 (17%)
Clic3NP_001013098.2 O-ClC 6..230 CDD:129941 33/178 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348166
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.