DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and GSTT2

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_000845.2 Gene:GSTT2 / 2953 HGNCID:4642 Length:244 Species:Homo sapiens


Alignment Length:177 Identity:47/177 - (26%)
Similarity:87/177 - (49%) Gaps:9/177 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYP 68
            |..|:....:.::.:||:..:.:|::||....:|||.|..|.:.||.|||:||..||...|..||
Human    22 KKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYP 86

  Fly    69 KDIQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQFGSEEDYKKVQ-------ETFDFL-NTFL 125
            .|:|.:|.:::.|.:....:..|.....:........|.:...:||:       :...:| :.||
Human    87 SDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEKVERNRTAMDQALQWLEDKFL 151

  Fly   126 EGQDYVAGDQYTVADIAILANVSNFDVVGFDISK-YPNVARWYDHVK 171
            ..:.::||.|.|:||:..|..:.....:|:::.: .|.:|.|...|:
Human   152 GDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVE 198

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 19/53 (36%)
GstA 6..173 CDD:223698 46/175 (26%)
GST_C_Delta_Epsilon 72..188 CDD:198287 22/109 (20%)
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 19/55 (35%)
GstA 14..210 CDD:223698 47/177 (27%)