DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and GSTT1

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_000844.2 Gene:GSTT1 / 2952 HGNCID:4641 Length:240 Species:Homo sapiens


Alignment Length:179 Identity:45/179 - (25%)
Similarity:83/179 - (46%) Gaps:20/179 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPKDIQ 72
            :.|..:|::.:||:.::..|.::||...:|.|.|..||:.||.|||:||..||...|..||:|:|
Human    26 IPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQ 90

  Fly    73 KQAVINQRLYFDMA-------------LMYPTLANYYYKAFTTGQFGSEEDYKKVQETFDFL-NT 123
            .:|.:::.|.:...             :|:|..........|.....:|.|.     |...| :.
Human    91 ARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDV-----TLQLLEDK 150

  Fly   124 FLEGQDYVAGDQYTVADIAILANVSNFDVVGFDISK-YPNVARWYDHVK 171
            ||:.:.::.|...::||:..:..:.:....|..:.: .|.:|.|...|:
Human   151 FLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVE 199

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 19/49 (39%)
GstA 6..173 CDD:223698 45/179 (25%)
GST_C_Delta_Epsilon 72..188 CDD:198287 20/115 (17%)
GSTT1NP_000844.2 GST_N_Theta 3..78 CDD:239348 19/51 (37%)