DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and CLIC4

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_039234.1 Gene:CLIC4 / 25932 HGNCID:13518 Length:253 Species:Homo sapiens


Alignment Length:167 Identity:32/167 - (19%)
Similarity:63/167 - (37%) Gaps:64/167 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPKDIQKQAVINQRLYFDMALMY 89
            |.::|::|:|.            ||....:.:..|:    :.|.|:.:.:|  |:.|  :..|: 
Human   102 PKYLKLSPKHP------------ESNTAGMDIFAKF----SAYIKNSRPEA--NEAL--ERGLL- 145

  Fly    90 PTLANYYYKAFTTGQFGSEEDYKKVQETFDFLNTFLEGQ--------------DYVAGDQYTVAD 140
                                  |.:|:..::||:.|..:              .::.|::.|:||
Human   146 ----------------------KTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLAD 188

  Fly   141 IAILANVSNFDVVGFDISKYPNVARWYDHVKKITPGW 177
            ..:|..:....||.   .||.|    :|..|::|..|
Human   189 CNLLPKLHIVKVVA---KKYRN----FDIPKEMTGIW 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 6/32 (19%)
GstA 6..173 CDD:223698 30/161 (19%)
GST_C_Delta_Epsilon 72..188 CDD:198287 23/120 (19%)
CLIC4NP_039234.1 Required for insertion into the membrane. /evidence=ECO:0000305 2..101
O-ClC 17..252 CDD:129941 32/167 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154232
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.