DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and Gstt1

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_445745.1 Gene:Gstt1 / 25260 RGDID:2765 Length:240 Species:Rattus norvegicus


Alignment Length:180 Identity:48/180 - (26%)
Similarity:84/180 - (46%) Gaps:14/180 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYP 68
            |...:.|....:...|||.::..|.::||...:|.:.|.|||:.||.|||:||..||...|..||
  Rat    22 KKNNIPFQMHTVELRKGEHLSDAFAQVNPMKKVPAMKDGGFTLCESVAILLYLAHKYKVPDHWYP 86

  Fly    69 KDIQKQAVINQRLYFD-MALMYPTLANYYYKAFTTGQFGSEEDYKKVQETFDFLNT--------F 124
            :|:|.:|.:::.|.:. ..|....|...::|.......|.:...:.:..|...|:.        |
  Rat    87 QDLQARARVDEYLAWQHTTLRRSCLRTLWHKVMFPVFLGEQIRPEMLAATLADLDVNVQVLEDQF 151

  Fly   125 LEGQDYVAGDQYTVADIAILANVSNFDVVGFDISKY---PNVARWYDHVK 171
            |:.:|::.|...::||:..:..:.:  .||.....:   |.:|.||..|:
  Rat   152 LQDKDFLVGPHISLADVVAITELMH--PVGGGCPVFEGRPRLAAWYRRVE 199

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 20/53 (38%)
GstA 6..173 CDD:223698 47/178 (26%)
GST_C_Delta_Epsilon 72..188 CDD:198287 22/112 (20%)
Gstt1NP_445745.1 GST_N_Theta 3..78 CDD:239348 20/55 (36%)