DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and GstE9

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster


Alignment Length:172 Identity:62/172 - (36%)
Similarity:98/172 - (56%) Gaps:9/172 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPK 69
            ||||::..:::|.|.||....:|...||||::|.|.|:|..||||.||..|||.:|.|.|.||||
  Fly    24 ALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIWESHAICAYLVRRYAKSDDLYPK 88

  Fly    70 DIQKQAVINQRLYFDMALMYP-TLAN----YYYKAFTTGQFGSEEDYKKVQETFDFLNTFLEGQD 129
            |..|:|:::|||:|:..:::. .:.|    .:||..|.   ........:.|.:|||..|:..|.
  Fly    89 DYFKRALVDQRLHFESGVLFQGCIRNIAIPLFYKNITE---VPRSQIDAIYEAYDFLEAFIGNQA 150

  Fly   130 YVAGDQYTVADIAILANVSNF-DVVGFDISKYPNVARWYDHV 170
            |:.|...|:||.:::::||:. .:...|..:||.:..|.|.:
  Fly   151 YLCGPVITIADYSVVSSVSSLVGLAAIDAKRYPKLNGWLDRM 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 25/52 (48%)
GstA 6..173 CDD:223698 61/171 (36%)
GST_C_Delta_Epsilon 72..188 CDD:198287 28/105 (27%)
GstE9NP_725784.1 GstA 4..201 CDD:223698 62/172 (36%)
GST_N_Delta_Epsilon 4..76 CDD:239343 24/51 (47%)
GST_C_Delta_Epsilon 92..209 CDD:198287 28/104 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460344
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518126at33208
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.