Sequence 1: | NP_788656.1 | Gene: | GstD3 / 48336 | FlyBaseID: | FBgn0010039 | Length: | 199 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006524198.1 | Gene: | Clic5 / 224796 | MGIID: | 1917912 | Length: | 485 | Species: | Mus musculus |
Alignment Length: | 204 | Identity: | 43/204 - (21%) |
---|---|---|---|
Similarity: | 70/204 - (34%) | Gaps: | 67/204 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 GLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPKDI 71
Fly 72 QKQAVINQRLYFDMALMYPTLANYYYKAFTTG--QFGSEEDY-----------------KKVQET 117
Fly 118 FDFLN--------TFLEGQD------YVAGDQYTVADIAILANVSNFDVVGFDISKYPNVARWYD 168
Fly 169 HVKKITPGW 177 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD3 | NP_788656.1 | GST_N_Delta_Epsilon | <1..58 | CDD:239343 | 12/50 (24%) |
GstA | 6..173 | CDD:223698 | 41/198 (21%) | ||
GST_C_Delta_Epsilon | 72..188 | CDD:198287 | 29/139 (21%) | ||
Clic5 | XP_006524198.1 | O-ClC | 248..483 | CDD:129941 | 43/204 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844778 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |