DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and Clic5

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_006524198.1 Gene:Clic5 / 224796 MGIID:1917912 Length:485 Species:Mus musculus


Alignment Length:204 Identity:43/204 - (21%)
Similarity:70/204 - (34%) Gaps:67/204 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPKDI 71
            |:.||   :.|:..::...|...:.|....|.|..||....:...|..:|      ::.|.|:  
Mouse   280 GVVFN---VTTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFL------EETLTPE-- 333

  Fly    72 QKQAVINQRLYFDMALMYPTLANYYYKAFTTG--QFGSEEDY-----------------KKVQET 117
                            .||.||..:.::.|.|  .|.....|                 |.:::.
Mouse   334 ----------------KYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALRKL 382

  Fly   118 FDFLN--------TFLEGQD------YVAGDQYTVADIAILANVSNFDVVGFDISKYPNVARWYD 168
            .|:||        |...|.:      ::.||:.|:||..:|..:   .||.....||.|    ||
Mouse   383 DDYLNSPLPEEIDTNTHGDEKGSQRKFLDGDELTLADCNLLPKL---HVVKIVAKKYRN----YD 440

  Fly   169 HVKKITPGW 177
            ...::|..|
Mouse   441 IPAEMTGLW 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 12/50 (24%)
GstA 6..173 CDD:223698 41/198 (21%)
GST_C_Delta_Epsilon 72..188 CDD:198287 29/139 (21%)
Clic5XP_006524198.1 O-ClC 248..483 CDD:129941 43/204 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844778
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.