DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and Vars1

DIOPT Version :10

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_035820.3 Gene:Vars1 / 22321 MGIID:90675 Length:1263 Species:Mus musculus


Alignment Length:154 Identity:38/154 - (24%)
Similarity:62/154 - (40%) Gaps:31/154 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PQHSIPTLVD--NGFTIWESRAILVYLVEKYGKDDALYPKDI-----QKQAVINQR--LYFDMAL 87
            |...:|.|..  .|..:|.:.|:.          ..|:|..:     .:.||:.|:  .|.|..|
Mouse    53 PPPRLPALEQGPGGLWVWGAPAVA----------QLLWPAGLGGPGGSRAAVLVQQWVSYADTEL 107

  Fly    88 MYPTLANYYYKAFTTGQFGSEEDYK----KVQETFDFLNTFLEGQDYVAGDQYTVADI-AILANV 147
            : |........|.  |..|..:|.:    .:.:..:.|..:|....|:|||..|:||: |:.|.:
Mouse   108 I-PAACGATLPAL--GLRGPGQDPQAALGALGKALNPLEDWLRLHTYLAGDAPTLADLAAVTALL 169

  Fly   148 SNFDVVGFDISK---YPNVARWYD 168
            ..|..| .|.|.   :.||.||::
Mouse   170 LPFRYV-LDPSARRIWGNVTRWFN 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 6/27 (22%)
GST_C_Delta_Epsilon 72..188 CDD:198287 30/107 (28%)
Vars1NP_035820.3 GST_C_family 92..213 CDD:470672 30/105 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..294
PTZ00419 281..1263 CDD:240411
'HIGH' region 343..353
'KMSKS' region 861..865
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.