DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and gst-42

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_509962.1 Gene:gst-42 / 183911 WormBaseID:WBGene00001790 Length:214 Species:Caenorhabditis elegans


Alignment Length:170 Identity:51/170 - (30%)
Similarity:73/170 - (42%) Gaps:22/170 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPKDIQ 72
            :::..|.::.| .|:......:|||...:||.|.:|..|.||.||:.||.|.: .|..|.|||..
 Worm    29 VDYEYKTVDLL-SEEAKSKLKEINPAAKVPTFVVDGQVITESLAIIEYLEETH-PDVPLLPKDPI 91

  Fly    73 KQAVIN----------QRLYFDMALMYPTLANYYYKAFTTGQFGSEEDYKKVQETFDFLNTFLEG 127
            |:|...          |.|:   .|....|.|.....| .|||..:    .|.|....|...|:.
 Worm    92 KRAHARAISLLVASGIQPLH---NLKVLQLLNKKEAGF-GGQFAKQ----FVVEGLTALEILLKQ 148

  Fly   128 QD--YVAGDQYTVADIAILANVSNFDVVGFDISKYPNVAR 165
            ..  |..||..|:||::|...:.:.:....|:|.||.|.|
 Worm   149 HSGKYAVGDDVTIADLSIPPLIYSANRFNLDLSPYPTVNR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 17/49 (35%)
GstA 6..173 CDD:223698 51/170 (30%)
GST_C_Delta_Epsilon 72..188 CDD:198287 28/106 (26%)
gst-42NP_509962.1 GST_N_Zeta 6..77 CDD:239340 16/48 (33%)
maiA 7..211 CDD:273527 51/170 (30%)
GST_C_Zeta 90..207 CDD:198300 28/107 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1283865at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.