DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and Gstz1

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_034493.1 Gene:Gstz1 / 14874 MGIID:1341859 Length:216 Species:Mus musculus


Alignment Length:175 Identity:51/175 - (29%)
Similarity:85/175 - (48%) Gaps:20/175 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GLEFNKKIINTLK--GEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPK 69
            |:::....||.:|  |:|...:|..:||...:|.|..:|.||.:|.||:.|| |:......|.|:
Mouse    28 GIDYEIVPINLIKDGGQQFTEEFQTLNPMKQVPALKIDGITIVQSLAIMEYL-EETRPIPRLLPQ 91

  Fly    70 DIQKQAVINQRLYFDM-ALMYPTLANYYYKAFTTGQFGSEEDYKKVQET----FDFLNTFLEGQ- 128
            |.||:|::  |:..|: |.....|.|    .....|.|.|...:..|:.    |:.|...|:.. 
Mouse    92 DPQKRAIV--RMISDLIASGIQPLQN----LSVLKQVGQENQMQWAQKVITSGFNALEKILQSTA 150

  Fly   129 -DYVAGDQYTVADIAILANVSNFDVVGFDISKYPNVARWYDHVKK 172
             .|..||:.::||:.::..|:|.:....|:|.||.::    |:.|
Mouse   151 GKYCVGDEVSMADVCLVPQVANAERFKVDLSPYPTIS----HINK 191

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 19/52 (37%)
GstA 6..173 CDD:223698 51/175 (29%)
GST_C_Delta_Epsilon 72..188 CDD:198287 28/108 (26%)
Gstz1NP_034493.1 GST_N_Zeta 6..80 CDD:239340 19/52 (37%)
maiA 7..211 CDD:273527 51/175 (29%)
Glutathione binding 14..19