DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and GSTO2

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_899062.1 Gene:GSTO2 / 119391 HGNCID:23064 Length:243 Species:Homo sapiens


Alignment Length:183 Identity:37/183 - (20%)
Similarity:67/183 - (36%) Gaps:36/183 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LKGEQMNPDFIKIN------------PQHSIPTL-VDNGFTIWESRAILVYLVEKY-GKDDALYP 68
            ||.:.:..:.:.||            |...||.| ......|:||.....||.:.| |:  .|:|
Human    42 LKAKDIRHEVVNINLRNKPEWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGR--KLFP 104

  Fly    69 KDIQKQAVINQRLYFDMALMYPTLANYYYKAFTTG------QFGSEEDYKKVQETFDFLNTFLEG 127
            .|..::|  .|::..::....|.|......|...|      :....:::..::|..::.||    
Human   105 YDPYERA--RQKMLLELFCKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNT---- 163

  Fly   128 QDYVAGDQYTVADIAILANVSNFDVVGF--DISKYPNVARWYDHVKKITPGWE 178
             .:..|...::.|..:.......||.|.  .:|..|.:..|...:|     |:
Human   164 -TFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMK-----WD 210

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 13/52 (25%)
GstA 6..173 CDD:223698 36/176 (20%)
GST_C_Delta_Epsilon 72..188 CDD:198287 19/115 (17%)
GSTO2NP_899062.1 Thioredoxin_like 7..94 CDD:320948 12/51 (24%)