DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and CLIC2

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001280.3 Gene:CLIC2 / 1193 HGNCID:2063 Length:247 Species:Homo sapiens


Alignment Length:207 Identity:45/207 - (21%)
Similarity:77/207 - (37%) Gaps:82/207 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GLEFNKKIIN-TLKGEQM-------NPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKD 63
            |::||...:: |.|.|::       ||.|                         |||  .|..|.
Human    44 GVKFNVTTVDMTRKPEELKDLAPGTNPPF-------------------------LVY--NKELKT 81

  Fly    64 DALYPKDIQKQAVINQRLYFDMALMYPTLANYYYKAFTTG-----QFGS--EEDYKKVQETF--- 118
            |.:..::..:|.:...|        ||.|:..|.::|..|     :|.:  :...|:..:.|   
Human    82 DFIKIEEFLEQTLAPPR--------YPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKS 138

  Fly   119 ---------DFLNT-FLEGQD-------------YVAGDQYTVADIAILANVSNFDVVG-----F 155
                     |:||| .|:..|             ::.|||.|:||.::|..::...|..     |
Human   139 LLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDF 203

  Fly   156 DI-SKYPNVARW 166
            || :::..|.|:
Human   204 DIPAEFSGVWRY 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 12/58 (21%)
GstA 6..173 CDD:223698 45/207 (22%)
GST_C_Delta_Epsilon 72..188 CDD:198287 30/134 (22%)
CLIC2NP_001280.3 Required for insertion into the membrane. /evidence=ECO:0000250 1..96 16/78 (21%)
N-terminal 1..94 16/76 (21%)
O-ClC 12..245 CDD:129941 45/207 (22%)
Joint loop 95..106 4/18 (22%)
C-terminal 107..247 24/109 (22%)
Foot loop 151..171 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154400
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.