DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD3 and CLIC1

DIOPT Version :9

Sequence 1:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001274522.1 Gene:CLIC1 / 1192 HGNCID:2062 Length:241 Species:Homo sapiens


Alignment Length:179 Identity:37/179 - (20%)
Similarity:62/179 - (34%) Gaps:45/179 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYL-----VEKYGKDDAL 66
            |:.||   :.|:..::......|:.|...:|.|:.......::..|..:|     ..:|.|..||
Human    38 GVTFN---VTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAAL 99

  Fly    67 YPK------DI---------QKQAVINQRLYFDMALMYPTLANYYYKAFTTGQFGSEEDYKKVQE 116
            .|:      ||         .....:|..|...:......|.||     .|.....|.|....::
Human   100 NPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNY-----LTSPLPEEVDETSAED 159

  Fly   117 TFDFLNTFLEG---QDYVAGDQYTVADIAILANVSNFDVV-----GFDI 157
                     ||   :.::.|::.|:||..:|..:....||     ||.|
Human   160 ---------EGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTI 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 10/55 (18%)
GstA 6..173 CDD:223698 37/179 (21%)
GST_C_Delta_Epsilon 72..188 CDD:198287 20/94 (21%)
CLIC1NP_001274522.1 Required for insertion into the membrane 2..90 10/54 (19%)
O-ClC 6..241 CDD:129941 37/179 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154490
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.